AFM Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-AFM antibody: synthetic peptide directed towards the C terminal of human AFM. Synthetic peptide located within the following region: HADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCC
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	afamin
Database Link	NP_001124 Entrez Gene 173 Human UniProt ID P43652
Background	AFM is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. AFM is regulated developmentally, expressed in the liver and secreted into the bloodstream.
Synonyms	ALB2; ALBA; ALF
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Horse: 92%; Bovine: 92%; Rabbit: 92%; Dog: 91%
Reference Data
Protein Families	Druggable Genome, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.