EPB42 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-EPB42 antibody: synthetic peptide directed towards the middle region of human EPB42. Synthetic peptide located within the following region: ISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	80 kDa
Gene Name	erythrocyte membrane protein band 4.2
Database Link	NP_000110 Entrez Gene 2038 Human UniProt ID P16452
Background	Erythrocyte membrane protein band 4.2 is an ATP-binding protein which may regulate the association of protein 3 with ankyrin. It probably has a role in erythrocyte shape and mechanical property regulation. Mutations in the EPB42 gene are associated with recessive spherocytic elliptocytosis and recessively transmitted hereditary hemolytic anemia.
Synonyms	PA; SPH5
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Bovine: 85%; Pig: 77%; Guinea pig: 77%; Zebrafish: 75%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.