Claudin 4 (CLDN4) Rabbit Polyclonal Antibody

CAT#: TA334201

Rabbit Polyclonal Anti-CLDN4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of claudin 4 (CLDN4)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human claudin 4 (CLDN4), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human claudin 4 (CLDN4), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CLDN4 antibody is: synthetic peptide directed towards the C-terminal region of Human CLDN4. Synthetic peptide located within the following region: KREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAAS
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 22 kDa
Gene Name claudin 4
Background This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems.
Synonyms CPE-R; CPER; CPETR; CPETR1; hCPE-R; WBSCR8
Note Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Rat: 92%; Sheep: 92%; Guinea pig: 92%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...