Claudin 8 (CLDN8) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CLDN8 antibody: synthetic peptide directed towards the C terminal of human CLDN8. Synthetic peptide located within the following region: IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	claudin 8
Database Link	NP_955360 Entrez Gene 9073 Human UniProt ID P56748
Background	CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
Synonyms	HEL-S-79
Note	Immunogen Sequence Homology: Human: 100%; Horse: 85%; Bovine: 85%; Rabbit: 85%; Dog: 77%; Pig: 77%; Rat: 77%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.