GLUT9 (SLC2A9) Rabbit Polyclonal Antibody

CAT#: TA334159

Rabbit Polyclonal Anti-SLC2A9 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Transient overexpression lysate of solute carrier family 2 (facilitated glucose transporter), member 9 (SLC2A9), transcript variant 1
    • 100 ug

CNY 3080.00


Transient overexpression lysate of solute carrier family 2 (facilitated glucose transporter), member 9 (SLC2A9), transcript variant 2
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-SLC2A9 Antibody: synthetic peptide directed towards the middle region of human SLC2A9. Synthetic peptide located within the following region: VVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 56 kDa
Gene Name solute carrier family 2 member 9
Background SLC2A9 is a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. SLC2A9 may play a role in the development and survival of chondrocytes in cartilage matrices.This gene encodes a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. The encoded protein may play a role in the development and survival of chondrocytes in cartilage matrices. Two transcript variants encoding distinct isoforms have been identified for this gene.
Synonyms GLUT9; GLUTX; UAQTL2; URATv1
Note Immunogen sequence homology: Human: 100%; Horse: 93%; Pig: 91%; Guinea pig: 91%; Dog: 86%; Mouse: 86%; Bovine: 86%; Rat: 79%; Rabbit: 79%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...