REEP3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-REEP3 Antibody is: synthetic peptide directed towards the C-terminal region of Human REEP3. Synthetic peptide located within the following region: HDLTTIQGDEPVGQRPYQPLPEAKKKSKPAPSESAGYGIPLKDGDEKTDE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	receptor accessory protein 3
Database Link	NP_001001330 Entrez Gene 221035 Human UniProt ID Q6NUK4
Background	REEP3 may enhance the cell surface expression of odorant receptors.
Synonyms	C10orf74; Yip2b
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 86%; Rabbit: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.