LIPK Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LIPK Antibody is: synthetic peptide directed towards the N-terminal region of Human LIPK. Synthetic peptide located within the following region: LLGSMYGYDKKGNNANPEANMNISQIISYWGYPYEEYDVTTKDGYILGIY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	lipase family member K
Database Link	NP_001073987 Entrez Gene 643414 Human UniProt ID Q5VXJ0
Background	LIPK plays a highly specific role in the last step of keratinocyte differentiation. It may have an essential function in lipid metabolism of the most differentiated epidermal layers.
Synonyms	bA186O14.2; LIPL2
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.