CAT1 (SLC7A1) Rabbit Polyclonal Antibody
CAT#: TA334048
Rabbit Polyclonal Anti-SLC7A1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SLC7A1 Antibody: synthetic peptide directed towards the N terminal of human SLC7A1. Synthetic peptide located within the following region: LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 68 kDa |
Gene Name | solute carrier family 7 member 1 |
Database Link | |
Background | SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic retroviral leukemia receptor. |
Synonyms | ATRC1; CAT-1; ERR; HCAT1; REC1L |
Note | Immunogen sequence homology: Human: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Pig: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |