SUPT5H Rabbit Polyclonal Antibody
CAT#: TA334033
Rabbit Polyclonal Anti-SUPT5H Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 4840.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SUPT5H Antibody: synthetic peptide directed towards the C terminal of human SUPT5H. Synthetic peptide located within the following region: PYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 121 kDa |
Gene Name | SPT5 homolog, DSIF elongation factor subunit |
Database Link | |
Background | SUPT5H and its binding partner regulate transcriptional elongation by RNA polymerase II. SPT4 and SPT5 are involved in both 5,6-dichloro-1-beta-D-ribofuranosylbenzimidazole (DRB)-mediated transcriptional inhibition and the activation of transcriptional elongation by the human immunodeficiency virus type 1 (HIV-1) Tat protein. |
Synonyms | SPT5; SPT5H; Tat-CT1 |
Note | Immunogen sequence homology: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; African clawed frog: 92%; Zebrafish: 92% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |