TFIISH (TCEA3) Rabbit Polyclonal Antibody
CAT#: TA334026
Rabbit Polyclonal Anti-TCEA3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TCEA3 Antibody: synthetic peptide directed towards the middle region of human TCEA3. Synthetic peptide located within the following region: KSTDMKYRNRVRSRISNLKDPRNPGLRRNVLSGAISAGLIAKMTAEEMAS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 39 kDa |
Gene Name | transcription elongation factor A3 |
Database Link | |
Background | Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human TCEA3 with an internal ID of P04456 |
Synonyms | TFIIS; TFIIS.H |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 92%; Guinea pig: 92%; Mouse: 85% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |