EAAT3 (SLC1A1) Rabbit Polyclonal Antibody
CAT#: TA333982
Rabbit Polyclonal Anti-SLC1A1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SLC1A1 Antibody: synthetic peptide directed towards the N terminal of human SLC1A1. Synthetic peptide located within the following region: LDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAI |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 57 kDa |
Gene Name | solute carrier family 1 member 1 |
Database Link | |
Background | This gene encodes a member of the high-affinity glutamate transporters that play an essential role in transporting glutamate across plasma membranes. In brain, these transporters are crucial in terminating the postsynaptic action of the neurotransmitter glutamate, and in maintaining extracellular glutamate concentrations below neurotoxic levels. This transporter also transports aspartate, and mutations in this gene are thought to cause dicarboxylicamino aciduria, also known as glutamate-aspartate transport defect. [provided by RefSeq, Mar 2010] |
Synonyms | DCBXA; EAAC1; EAAT3; SCZD18 |
Note | Immunogen sequence homology: Human: 100%; Rat: 92%; Mouse: 85%; Dog: 77% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |