SLC7A4 Rabbit Polyclonal Antibody
CAT#: TA333980
Rabbit Polyclonal Anti-SLC7A4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SLC7A4 Antibody: synthetic peptide directed towards the middle region of human SLC7A4. Synthetic peptide located within the following region: GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFIVAAGSICAMN |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 68 kDa |
Gene Name | solute carrier family 7 member 4 |
Database Link | |
Background | SLC7A4 is involved in the transport of the cationic amino acids (arginine, lysine and ornithine). |
Synonyms | CAT-4; CAT4; HCAT3; VH |
Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 86%; Dog: 85%; Zebrafish: 75% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |