ZNF235 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF235 Antibody is: synthetic peptide directed towards the N-terminal region of HUMAN ZNF235. Synthetic peptide located within the following region: FRNLVSVGHQSFKPDMISQLEREEKLWMKELQTQRGKHSGDRNQNEMATL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	81 kDa
Gene Name	zinc finger protein 235
Database Link	NP_004225 Entrez Gene 9310 Human UniProt ID Q14590
Background	This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein is a member of the Kruppel family of zinc finger proteins, and contains Kruppel-associated box (KRAB) A and B domains and 15 tandemly arrayed C2H2-type zinc fingers. It is an ortholog of the mouse Zfp93 protein. This gene is located in a cluster of zinc finger genes on 19q13.2.
Synonyms	ANF270; HZF6; ZFP93; ZNF270
Note	Immunogen sequence homology: Human: 100%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Pig: 83%; Guinea pig: 83%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.