NDUFB4 Rabbit Polyclonal Antibody
CAT#: TA333970
Rabbit Polyclonal Anti-NDUFB4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-NDUFB4 Antibody is: synthetic peptide directed towards the C-terminal region of Human NDUFB4. Synthetic peptide located within the following region: ARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGK |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 14 kDa |
Gene Name | NADH:ubiquinone oxidoreductase subunit B4 |
Database Link | |
Background | This gene encodes a non-catalytic subunit of the multisubunit NADH:ubiquinone oxidoreductase, the first enzyme complex in the mitochondrial electron transport chain (complex I). Mammalian complex I is composed of 45 different subunits and transfers electrons from NADH to ubiquinone. |
Synonyms | B15; CI-B15 |
Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Bovine: 93%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 79% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |