SLC17A4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC17A4 Antibody: synthetic peptide directed towards the middle region of human SLC17A4. Synthetic peptide located within the following region: YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	solute carrier family 17 member 4
Database Link	NP_005486 Entrez Gene 10050 Human UniProt ID Q9Y2C5
Background	As a Na/PO4 cotransporter, SLC17A4 may be important to the regulation of Li transport and its therapeutic effects.
Synonyms	KAIA2138
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Bovine: 93%; Pig: 79%; Guinea pig: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.