CLEC3A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CLEC3A Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC3A. Synthetic peptide located within the following region: GKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	C-type lectin domain family 3 member A
Database Link	NP_005743 Entrez Gene 10143 Human UniProt ID O75596
Background	CLEC3A promotes cell adhesion to laminin-332 and fibronectin.
Synonyms	CLECSF1
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 86%; Zebrafish: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.