ZNF24 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF24 Antibody: synthetic peptide directed towards the middle region of human ZNF24. Synthetic peptide located within the following region: CDDDGRTENGALAPKQELPSALESHEVPGTLSMGVPQIFKYGETCFPKGR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	zinc finger protein 24
Database Link	NP_008896 Entrez Gene 7572 Human UniProt ID P17028
Background	ZNF24 is a new candidate transcription factor.
Synonyms	KOX17; RSG-A; Zfp191; ZNF191; ZSCAN3
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 92%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.