SLC35D2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC35D2 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC35D2. Synthetic peptide located within the following region: LIGGDYIFSLLNFVGLNICMAGGLRYSFLTLSSQLKPKPVGEENICLDLK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	solute carrier family 35 member D2
Database Link	NP_008932 Entrez Gene 11046 Human UniProt ID Q76EJ3
Background	Nucleotide sugars, which are synthesized in the cytosol or the nucleus, are high-energy donor substrates for glycosyltransferases located in the lumen of the endoplasmic reticulum and Golgi apparatus. Translocation of nucleotide sugars from the cytosol into the lumen compartment is mediated by specific nucleotide sugar transporters, such as SLC35D2.
Synonyms	hfrc; HFRC1; SQV7L; UGTrel8
Note	Immunogen sequence homology: Human: 100%; Pig: 87%; Mouse: 86%; Bovine: 80%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.