DAK (TKFC) Rabbit Polyclonal Antibody
CNY 4628.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | IHC, WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-DAK Antibody: synthetic peptide directed towards the N terminal of human DAK. Synthetic peptide located within the following region: MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 59 kDa |
Gene Name | triokinase and FMN cyclase |
Database Link | |
Background | This gene is a member of the family of dihydroxyacetone kinases, which have a protein structure distinct from other kinases. The product of this gene phosphorylates dihydroxyacetone, and also catalyzes the formation of riboflavin 4',5'-phosphate (aka cyclin FMN) from FAD. Several alternatively spliced transcript variants have been identified, but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008] |
Synonyms | DAK; NET45 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Glycerolipid metabolism, Metabolic pathways, RIG-I-like receptor signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |