WDR21A (DCAF4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DCAF4 Antibody: synthetic peptide directed towards the middle region of human DCAF4. Synthetic peptide located within the following region: ARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLYCYSYS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	DDB1 and CUL4 associated factor 4
Database Link	NP_056419 Entrez Gene 26094 Human UniProt ID Q8WV16
Background	DCAF4 is a WD repeat-containing protein. The function of DCAF4 remains unknown.This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Synonyms	WDR21; WDR21A
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 86%; Rat: 86%; Horse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.