PGRP1B (PGLYRP4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PGLYRP4 Antibody is: synthetic peptide directed towards the N-terminal region of Human PGLYRP4. Synthetic peptide located within the following region: LGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	peptidoglycan recognition protein 4
Database Link	NP_065126 Entrez Gene 57115 Human UniProt ID Q96LB8
Background	Peptidoglycan recognition proteins, such as PGRPI-beta, are part of the innate immune system and recognize peptidoglycan, a ubiquitous component of bacterial cell walls.
Synonyms	PGLYRPIbeta; PGRP-Ibeta; PGRPIB; SBBI67
Note	Immunogen sequence homology: Human: 100%; Rat: 75%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.