KCC2 (SLC12A5) Rabbit Polyclonal Antibody

CAT#: TA333736

Rabbit Polyclonal Anti-SLC12A5 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of solute carrier family 12 (potassium-chloride transporter), member 5 (SLC12A5), transcript variant 2
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Purified recombinant protein of Human solute carrier family 12 (potassium/chloride transporter), member 5 (SLC12A5), transcript variant 2, with C-terminal MYC/DDK tag, expressed in HEK293 cells, 20 µg
    • 20 ug

CNY 2900.00


Purified recombinant protein of Human solute carrier family 12 (potassium/chloride transporter), member 5 (SLC12A5), transcript variant 2, with C-terminal MYC/DDK tag, expressed in HEK293 cells, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-SLC12A5 Antibody: synthetic peptide directed towards the middle region of human SLC12A5. Synthetic peptide located within the following region: VQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKG
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 123 kDa
Gene Name solute carrier family 12 member 5
Background K-Cl cotransporters are proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential. The protein encoded by this gene is an integral membrane K-Cl cotransporter that can function in either a net efflux or influx pathway, depending on the chemical concentration gradients of potassium and chloride. The encoded protein can act as a homomultimer, or as a heteromultimer with other K-Cl cotransporters, to maintain chloride homeostasis in neurons. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Sep 2008]
Synonyms EIEE34; EIG14; hKCC2; KCC2
Note Immunogen sequence homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Mouse: 92%; Horse: 86%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...