ZFP106 (ZNF106) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZFP106 Antibody: synthetic peptide directed towards the N terminal of human ZFP106. Synthetic peptide located within the following region: QKESELQMTSAASPHPGLLLDLKTSLEDAQVDDSIKSHVSYETEGFESAS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	209 kDa
Gene Name	zinc finger protein 106
Database Link	NP_071918 Entrez Gene 64397 Human UniProt ID Q9H2Y7
Background	ZFP106 is a new candidate transcription factor
Synonyms	SH3BP3; ZFP106; ZNF474
Note	Immunogen sequence homology: Human: 100%; Dog: 86%; Rabbit: 86%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.