ZNF447 (ZSCAN18) Rabbit Polyclonal Antibody
CAT#: TA333689
Rabbit Polyclonal Anti-ZNF447 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ZNF447 Antibody: synthetic peptide directed towards the N terminal of human ZNF447. Synthetic peptide located within the following region: PADLEFSRLRFREFVYQEAAGPHQTLARLHELCRQWLMPEARSKEQMLEL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 55 kDa |
Gene Name | zinc finger and SCAN domain containing 18 |
Database Link | |
Background | ZNF447 contains 1 SCAN box domain and 2 C2H2-type zinc fingers. It belongs to the kruppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. |
Synonyms | ZNF447 |
Note | Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 85% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |