SNIP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SNIP1 Antibody: synthetic peptide directed towards the middle region of human SNIP1. Synthetic peptide located within the following region: RNDVGGGGSESQELVPRPGGNNKEKEVPAKEKPSFELSGALLEDTNTFRG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	Smad nuclear interacting protein 1
Database Link	NP_078976 Entrez Gene 79753 Human UniProt ID Q8TAD8
Background	Smad-binding peptide aptamers can be developed to selectively inhibit TGF-beta-induced gene expression.
Synonyms	PMRED
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 92%; Guinea pig: 92%; Zebrafish: 82%; Rabbit: 81%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.