Nus1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Nus1 Antibody is: synthetic peptide directed towards the middle region of Mouse Nus1. Synthetic peptide located within the following region: RLMDEILKQQQELLGQDCSKYSAEFANSNDKDDQDLNCPSAVKVLSPEDG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	NUS1 dehydrodolichyl diphosphate synthase subunit
Database Link	NP_084526 Entrez Gene 52014 Mouse UniProt ID Q99LJ8
Background	Nus1 acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator. It regulates the stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol.
Synonyms	C6orf68; MGC7199; MGC117249; MGC:7199; NgBR
Note	Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Rabbit: 93%; Mouse: 92%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.