SLC2A10 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC2A10 Antibody: synthetic peptide directed towards the middle region of human SLC2A10. Synthetic peptide located within the following region: AKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	solute carrier family 2 member 10
Database Link	NP_110404 Entrez Gene 81031 Human UniProt ID O95528
Background	SLC2A10 is a member of the facilitative glucose transporter family, which plays a significant role in maintaining glucose homeostasis.SLC2A10 is a member of the facilitative glucose transporter family, which plays a significant role in maintaining glucose homeostasis. [supplied by OMIM]
Synonyms	ATS; GLUT10
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.