GNGT2 Rabbit Polyclonal Antibody

CAT#: TA333628

Rabbit Polyclonal Anti-GNGT2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 (GNGT2)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 (GNGT2), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 (GNGT2), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-GNGT2 Antibody: synthetic peptide directed towards the middle region of human GNGT2. Synthetic peptide located within the following region: KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 8 kDa
Gene Name G protein subunit gamma transducin 2
Background Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. GNGT2 is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones.Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. There is evidence for use of multiple polyadenylation sites by this gene.
Synonyms G-GAMMA-8; G-GAMMA-C; GNG8; GNG9; GNGT8
Note Immunogen sequence homology: Human: 100%; Dog: 93%; Bovine: 93%; Rabbit: 92%; Horse: 86%; Mouse: 86%; Rat: 85%; Pig: 77%; Sheep: 77%; Guinea pig: 77%
Reference Data
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...