SYDE2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SYDE2 Antibody is: synthetic peptide directed towards the N-terminal region of Human SYDE2. Synthetic peptide located within the following region: ENRVLSVPPDQRITLTDLFENAYGSSMKGRELEELKDNIEFRGHKPLNSI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	131 kDa
Gene Name	synapse defective Rho GTPase homolog 2
Database Link	NP_115560 Entrez Gene 84144 Human UniProt ID Q5VT97
Background	SYDE2 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
Synonyms	RP11-33E12.1
Note	Immunogen sequence homology: Human: 100%; Rat: 79%; Horse: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.