Prostein (SLC45A3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC45A3 Antibody: synthetic peptide directed towards the middle region of human SLC45A3. Synthetic peptide located within the following region: LFYTDFVGEGLYQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	solute carrier family 45 member 3
Database Link	NP_149093 Entrez Gene 85414 Human UniProt ID Q96JT2
Background	SLC45A3 is a multi-pass membrane protein. It belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2) family. It is a marker for prostate cells. It may be used, in case of prostate cancers, as a target antigen for protate carcinomas-directed cytotoxic T-cell lymphocytes.
Synonyms	IPCA-2; IPCA-6; IPCA-8; IPCA6; PCANAP2; PCANAP6; PCANAP8; PRST
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.