CCDC120 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CCDC120 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC120. Synthetic peptide located within the following region: SGSQDSQMGFPRADPASDRASLFVARTRRSNSSEALLVDRAAGGGAGSPP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	coiled-coil domain containing 120
Database Link	NP_296375 Entrez Gene 90060 Human UniProt ID Q96HB5
Background	This gene encodes a protein that contains a coiled-coil domain. Four alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
Synonyms	JM11
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 91%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.