SLC26A9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC26A9 Antibody: synthetic peptide directed towards the middle region of human SLC26A9. Synthetic peptide located within the following region: LAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	87 kDa
Gene Name	solute carrier family 26 member 9
Database Link	NP_443166 Entrez Gene 115019 Human UniProt ID Q7LBE3
Background	This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures yet have markedly different tissue expression patterns.
Synonyms	anion transporter; exchanger-9; member 9; OTTHUMP00000034236; OTTHUMP00000034326; solute carrier family 26
Note	Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 92%; Bovine: 92%; Rat: 85%; Rabbit: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.