G0 Protein alpha (GNAO1) Rabbit Polyclonal Antibody
CAT#: TA333538
Rabbit Polyclonal Anti-GNAO1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5200.00
Cited in 1 publication. |
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the middle region of human GNAO1. Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 40 kDa |
Gene Name | G protein subunit alpha o1 |
Database Link | |
Background | Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain. |
Synonyms | EIEE17; G-ALPHA-o; GNAO; HLA-DQB1 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Long-term depression, Melanogenesis |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Gross morphology, histology, and ultrastructure of the olfactory rosette of a critically endangered indicator species, the Delta Smelt, Hypomesus transpacificus
,null,
Journal of Comparative Physiology. A, Neuroethology, Sensory, Neural, and Behavioral Physiology
,PubMed ID 34156533
[GNAO1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它G0 Protein alpha产品