SLC25A46 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC25A46 Antibody: synthetic peptide directed towards the C terminal of human SLC25A46. Synthetic peptide located within the following region: LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	solute carrier family 25 member 46
Database Link	NP_620128 Entrez Gene 91137 Human UniProt ID Q96AG3
Background	SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.SLC25A46 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]). [supplied by OMIM]
Synonyms	HMSN6B
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.