SLC39A11 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC39A11 Antibody: synthetic peptide directed towards the middle region of human SLC39A11. Synthetic peptide located within the following region: GGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASATFESARNLAIG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	solute carrier family 39 member 11
Database Link	NP_631916 Entrez Gene 201266 Human UniProt ID Q8N1S5
Background	SLC39A11 belongs to the ZIP transporter (TC 2.A.5) family. It is a multi-pass membrane protein. SLC39A11 may act as a zinc-influx transporter.
Synonyms	C17orf26; ZIP11
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.