HYLS1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-HYLS1 Antibody: synthetic peptide directed towards the middle region of human HYLS1. Synthetic peptide located within the following region: YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	HYLS1, centriolar and ciliogenesis associated
Database Link	NP_659451 Entrez Gene 219844 Human UniProt ID Q96M11
Background	This protein is a protein localized to the cytoplasm. Mutations in this protein are associated with hydrolethalus syndrome.
Synonyms	HLS
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Bovine: 93%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Horse: 86%; Mouse: 86%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.