CCDC11 (CFAP53) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CCDC11 Antibody: synthetic peptide directed towards the N terminal of human CCDC11. Synthetic peptide located within the following region: YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	cilia and flagella associated protein 53
Database Link	NP_659457 Entrez Gene 220136 Human UniProt ID Q96M91
Background	The function of the CCDC11 protein remains unknown.
Synonyms	CCDC11; HTX6
Note	Immunogen sequence homology: Human: 100%; Bovine: 93%; Pig: 85%; Horse: 85%; Dog: 79%; Guinea pig: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.