Tpgs1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Tpgs1 Antibody is: synthetic peptide directed towards the middle region of Mouse Tpgs1. Synthetic peptide located within the following region: DGRTYSELLKRVCRDGGAPEEVVAPLLRKIQCRDHEAVPLGIFRTGMLSC
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	tubulin polyglutamylase complex subunit 1
Database Link	NP_683736 Entrez Gene 110012 Mouse UniProt ID Q99MS8
Background	Tpgs1 may act in the targeting of the tubulin polyglutamylase complex. It is required for the development of the spermatid flagellum.
Synonyms	AV005629; Gm16517; Gtrgeo22; PGs1
Note	Immunogen sequence homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Mouse: 92%; Bovine: 92%; Guinea pig: 92%; Rabbit: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.