CD300LD-AS1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C17orf77 Antibody is: synthetic peptide directed towards the C-terminal region of Human C17orf77. Synthetic peptide located within the following region: HVGAKEQEEPGGTQALRSCGIYCLEERTDKASHEECRERSTLGRPQCTGL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	chromosome 17 open reading frame 77
Database Link	NP_689673 Entrez Gene 146723 Human UniProt ID Q96MU5
Background	The function of this protein remains unknown.
Synonyms	FLJ31882
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.