COL6A5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-COL6A5 Antibody is: synthetic peptide directed towards the C-terminal region of Human COL6A5. Synthetic peptide located within the following region: RNVSLRAKCQGYSIFVFSFGPKHNDKELEELASHPLDHHLVQLGRTHKPD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	collagen type VI alpha 5
Database Link	NP_694996 Entrez Gene 256076 Human UniProt ID A8TX70
Background	The protein encoded by this gene is a collagen that contains N- and C-terminal von Willebrand factor A-like domains. The encoded protein may interact with the alpha 1 and alpha 2 chains of collagen VI to form the complete collagen VI trimer. Sequence polymorphisms in this gene have been linked to atopic dermatitis (eczema). Two transcript variants, one protein-coding and the other probably not protein-coding, have been found for this gene.
Synonyms	COL29A1; VWA4
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 86%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.