R3hdm4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-R3hdm4 Antibody is: synthetic peptide directed towards the N-terminal region of Mouse R3hdm4. Synthetic peptide located within the following region: MVALDNSEGGPEATPSGETRLSLPGCLPPLSGSQVKRVSASRRKQHFINQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	R3H domain containing 4
Database Link	NP_818775 Entrez Gene 109284 Mouse UniProt ID Q4VBF2
Background	The function of this protein remains unknown.
Synonyms	AI503502; C030046I01Rik
Note	Immunogen sequence homology: Human: 100%; Bovine: 100%; Pig: 93%; Dog: 92%; Mouse: 92%; Guinea pig: 92%; Rat: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.