GMCL1 Rabbit Polyclonal Antibody
CAT#: TA333433
Rabbit Polyclonal Anti-GMCL1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-GMCL1 Antibody is: synthetic peptide directed towards the N-terminal region of Human GMCL1. Synthetic peptide located within the following region: HGFCYCAGSHKRKRSSGSFCYCHPDSETDEDEEEGDEQQRLLNTPRRKKL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 57 kDa |
Gene Name | germ cell-less, spermatogenesis associated 1 |
Database Link | |
Background | This gene encodes a nuclear envelope protein that appears to be involved in spermatogenesis, either directly or by influencing genes that play a more direct role in the process. This multi-exon locus is the homolog of the mouse and drosophila germ cell-less gene but the human genome also contains a single-exon locus on chromosome 5 that contains an open reading frame capable of encoding a highly-related protein. |
Synonyms | BTBD13; GCL; GCL1; SPATA29 |
Note | Immunogen sequence homology: Human: 100%; Pig: 85%; Rat: 85%; Horse: 85%; Bovine: 85%; Mouse: 77%; Guinea pig: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |