C1orf110 (CCDC190) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C1orf110 Antibody: synthetic peptide directed towards the middle region of human C1orf110. Synthetic peptide located within the following region: SKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRVPSKFL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	coiled-coil domain containing 190
Database Link	NP_848645 Entrez Gene 339512 Human UniProt ID Q86UF4
Background	The exact functions of C1orf110 remain unknown.
Synonyms	C1orf110
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.