TBC1D26 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MGC51025 Antibody: synthetic peptide directed towards the middle region of human MGC51025. Synthetic peptide located within the following region: RGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSRIIHCIQLDVSHTLQKH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	TBC1 domain family member 26
Database Link	NP_848666 Entrez Gene 353149 Human UniProt ID Q86UD7
Background	MGC51025 may act as a GTPase-activating protein for Rab family protein(s).
Synonyms	FLJ55788; MGC51025
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.