SERINC2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SERINC2 Antibody: synthetic peptide directed towards the middle region of human SERINC2. Synthetic peptide located within the following region: SSIPEQKCNPHLPTQLGNETVVAGPEGYETQWWDAPSIVGLIIFLLCTLF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	serine incorporator 2
Database Link	NP_849196 Entrez Gene 347735 Human UniProt ID Q96SA4
Background	The specific function of this protein remains unknown.
Synonyms	FKSG84; PRO0899; TDE2; TDE2L
Note	Immunogen sequence homology: Human: 100%; Rat: 93%; Rabbit: 93%; Dog: 79%; Bovine: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.