ZNF50 (ZSCAN22) Rabbit Polyclonal Antibody
CAT#: TA333403
Rabbit Polyclonal Anti-ZSCAN22 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ZSCAN22 Antibody is: synthetic peptide directed towards the N-terminal region of Human ZSCAN22. Synthetic peptide located within the following region: RFRHFRYEEASGPHEALAHLRALCCQWLQPEAHSKEQILELLVLEQFLGA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 54 kDa |
Gene Name | zinc finger and SCAN domain containing 22 |
Database Link | |
Background | ZSCAN22 may be involved in transcriptional regulation. |
Synonyms | HKR2; ZNF50 |
Note | Immunogen sequence homology: Human: 100%; Rat: 93%; Rabbit: 92%; Mouse: 86%; Dog: 85%; Pig: 85%; Horse: 85%; Bovine: 85%; Guinea pig: 85% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |