LAT2 (SLC7A8) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC7A8 Antibody: synthetic peptide directed towards the middle region of human SLC7A8. Synthetic peptide located within the following region: PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	solute carrier family 7 member 8
Database Link	NP_877392 Entrez Gene 23428 Human UniProt ID Q9UHI5
Background	SLC7A8 is sodium-independent, high-affinity transport of large neutral amino acids. It has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. SLC7A8 also plays a role in basolateral (re)absorption of neutral amino acids.
Synonyms	LAT2; LPI-PC1
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.