Phospholipase C beta 1 (PLCB1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PLCB1 Antibody: synthetic peptide directed towards the middle region of human PLCB1. Synthetic peptide located within the following region: EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	134 kDa
Gene Name	phospholipase C beta 1
Database Link	NP_877398 Entrez Gene 18795 MouseEntrez Gene 23236 Human UniProt ID Q9NQ66
Background	The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction
Synonyms	EIEE12; PI-PLC; PLC-154; PLC-I; PLC154; PLCB1A; PLCB1B
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Alzheimer's disease, Calcium signaling pathway, Chemokine signaling pathway, Gap junction, GnRH signaling pathway, Huntington's disease, Inositol phosphate metabolism, Long-term depression, Long-term potentiation, Melanogenesis, Metabolic pathways, Phosphatidylinositol signaling system, Vascular smooth muscle contraction, Wnt signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.