TEX45 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C19orf45 Antibody: synthetic peptide directed towards the middle region of human C19orf45. Synthetic peptide located within the following region: QALPGPPALRCKRASSGVELGDCKISYGSTCSEQKQAYRPQDLPEDRYDK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	chromosome 19 open reading frame 45
Database Link	NP_940936 Entrez Gene 374877 Human UniProt ID Q8NA69
Background	The function of C19orf45 remains unknown.
Synonyms	FLJ35784; FLJ56642
Note	Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.