RIPK5 (DSTYK) Rabbit Polyclonal Antibody
CAT#: TA333333
Rabbit Polyclonal Anti-DSTYK Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-DSTYK Antibody: synthetic peptide directed towards the middle region of human RIPK5. Synthetic peptide located within the following region: EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 100 kDa |
Gene Name | dual serine/threonine and tyrosine protein kinase |
Database Link | |
Background | RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. Multiple alternatively spliced transcript variants have been found, but the biological validity of some variants has not been determined. |
Synonyms | CAKUT1; DustyPK; HDCMD38P; RIP5; RIPK5 |
Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Rat: 90%; Mouse: 86%; Bovine: 86%; Rabbit: 85% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |